Products

FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2), Human

No. Size Price Qty Status
RA-FD611 25ug $183.49
RA-FD612 100ug $780.91
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSP
HFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSV
PEASPSSPPAP with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Endotoxin Test:
<0.1 EU/μg by LAL method

Bioactivity (ED50):
0.553 ng/mL measured by its ability to induce 3T3 cells proliferation.

Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

SDS-PAGE analysis of recombinant human FGF-11 isoform 2



Storage: 

Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 7.4. Please use finished within one month after protein reconstitution.

 
Reviews for FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2), Human

Average Rating: 0 (0 Reviews )